PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01101.1.g00030.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 144aa    MW: 16307.7 Da    PI: 10.2735
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01101.1.g00030.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.38.2e-284291251
                                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  rie+++ rqvtfskRr g+lKKA+ELSvLCdaev +i+fs++g+ly ++s
  Zpz_sc01101.1.g00030.1.sm.mk 42 RIEDTTSRQVTFSKRRSGLLKKAFELSVLCDAEVGLIVFSPRGRLYQFPS 91
                                  8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.4133393IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-333392IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003589IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.19E-2935114IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-283555IPR002100Transcription factor, MADS-box
PfamPF003192.8E-264289IPR002100Transcription factor, MADS-box
CDDcd002657.56E-3543108No hitNo description
PRINTSPR004049.0E-285570IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-287091IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MVATAAMAAE AAPSPEGGDQ IVAEAPDGRK KLGRRGRREM RRIEDTTSRQ VTFSKRRSGL  60
LKKAFELSVL CDAEVGLIVF SPRGRLYQFP SAIELQKTID RYLNHTKGTN VNLKVDDLPG  120
IERWKWEATT LEKKIDEVEA HKRW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D1e-1728102168Myocyte-specific enhancer factor 2A
3mu6_C1e-1728102168Myocyte-specific enhancer factor 2A
3mu6_B1e-1728102168Myocyte-specific enhancer factor 2A
3mu6_A1e-1728102168Myocyte-specific enhancer factor 2A
3p57_J2e-1728102168Myocyte-specific enhancer factor 2A
3p57_I2e-1728102168Myocyte-specific enhancer factor 2A
3p57_D2e-1728102168Myocyte-specific enhancer factor 2A
3p57_C2e-1728102168Myocyte-specific enhancer factor 2A
3p57_B2e-1728102168Myocyte-specific enhancer factor 2A
3p57_A2e-1728102168Myocyte-specific enhancer factor 2A
3kov_J2e-1728102168Myocyte-specific enhancer factor 2A
3kov_I2e-1728102168Myocyte-specific enhancer factor 2A
3kov_B2e-1728102168Myocyte-specific enhancer factor 2A
3kov_A2e-1728102168Myocyte-specific enhancer factor 2A
1tqe_S2e-1728123290Myocyte-specific enhancer factor 2B
1tqe_R2e-1728123290Myocyte-specific enhancer factor 2B
1tqe_Q2e-1728123290Myocyte-specific enhancer factor 2B
1tqe_P2e-1728123290Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012701694.12e-50PREDICTED: MADS-box protein SOC1-like isoform X1
RefseqXP_012701695.12e-50PREDICTED: MADS-box protein SOC1-like isoform X2
SwissprotO646451e-39SOC1_ARATH; MADS-box protein SOC1
TrEMBLK3Z0C29e-48K3Z0C2_SETIT; Uncharacterized protein
STRINGSi019985m3e-47(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.17e-37AGAMOUS-like 20